Scaffold Ga0082396_116224

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0082396_116224

Scaffold Ga0082396_116224

Overview

Basic Information
Taxon OID	3300006236 Open in IMG/M
Scaffold ID	Ga0082396_116224 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities, 0.6 km from oil contamination, elevated hydrocarbon, Gulf of Mexico? BC350
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Yale Center for Genome Analysis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	601
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Gulf of Mexico
Coordinates	Lat. (^o)	28.3	Long. (^o)	-88.2	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056191	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082396_1162242	F056191	N/A	MICDARDRHALTAEMLEIFLSGGSMHASVKLEGIDGRAP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.