Basic Information | |
---|---|
Taxon OID | 3300006235 Open in IMG/M |
Scaffold ID | Ga0082395_1034737 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities, 33.9 km from oil contamination, ambient, Gulf of Mexico ? BC463 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Yale Center for Genome Analysis |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 813 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of Mexico | |||||||
Coordinates | Lat. (o) | 28.3 | Long. (o) | -88.2 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082867 | Metagenome / Metatranscriptome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0082395_10347371 | F082867 | N/A | RVVKPLTFTSNTLVLSVNPALTDLSNTLATIYRQYRVTELSFTFQASSDAGAYALAMQYVPQIGGTPSTLPTLLSEFEGPAVGYYETGRGREYTFRVPSDVLNAMGLNYYSTRTAVTPIQDPDILTQGLMVFLTSSPNIPVVAYMHVKYEFQTLEDPSFLASLFDDKKQDNDMLVVPRPGDVKGATWDENARGSIRGQSLGINHFSSVTQP* |
⦗Top⦘ |