Scaffold Ga0082391_120063

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0082391_120063

Scaffold Ga0082391_120063

Overview

Basic Information
Taxon OID	3300006231 Open in IMG/M
Scaffold ID	Ga0082391_120063 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities, 2.7 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC278
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Yale Center for Genome Analysis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1139
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Gulf of Mexico
Coordinates	Lat. (^o)	28.3	Long. (^o)	-88.2	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056191	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082391_1200631	F056191	AGG	MLTAEMFEILFSWGSMHASMKLEGIDGRAPPERVEHVA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.