Scaffold Ga0075446_10038920

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0075446_10038920

Scaffold Ga0075446_10038920

Overview

Basic Information
Taxon OID	3300006190 Open in IMG/M
Scaffold ID	Ga0075446_10038920 Open in IMG/M
Source Dataset Name	Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1508
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (20.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The West Antarctic Peninsula, For Metatranscriptomic Analysis

Source Dataset Sampling Location
Location Name	Atlantic Ocean: West Antarctic Peninsula
Coordinates	Lat. (^o)	-64.8156	Long. (^o)	-64.0406	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055859	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075446_100389202	F055859	N/A	MELCSDKNKKIMEDLILKLQTLLDEIEHEGLDLTEVNEKLKEIVEDGHNLCDDGYLEEETNF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.