Scaffold Ga0097682_1047315

Overview

Basic Information

• Taxon OID: 3300006185
• Scaffold ID: Ga0097682_1047315
• Source Dataset Name: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_1000_biof - 1398105538229 (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1130
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location

• Location Name: South Africa: Cape Town
• Coordinates
  • Lat. (^o): -33.927
  • Long. (^o): 18.452665

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081545	Metagenome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0097682_10473152	F081545	N/A	MDNQQLRSIIIKLESRLSDDDRERLHFYLGNDVPRKIRDDASLRGTLRLMDSLFDQDKINEQDFTFLIRAFEQIQCRDAVSLLKG*