Scaffold Ga0097677_1005808

Overview

Basic Information

• Taxon OID: 3300006183
• Scaffold ID: Ga0097677_1005808
• Source Dataset Name: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_500_biof - 1398105537950 (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5619
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location

• Location Name: South Africa: Cape Town
• Coordinates
  • Lat. (^o): -33.927
  • Long. (^o): 18.452665

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094111	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0097677_10058085	F094111	N/A	VRKIVRKSFHFDFVVLTLSYNQPRFCLNTSWNSNAMTFANRSFVGTYSPSIFVNSNNSIYILNLDTTQILIWQNENHLNLTRIILRDLLNPQSIFVTMNGDIYVDTADYLEGVDRWIAENETWISVMNVPSFCYGLFIDIYENLYCSAHNNQRVDKKWSNGTTTIVAGTG