NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079045_1000219

Scaffold Ga0079045_1000219


Overview

Basic Information
Taxon OID3300006180 Open in IMG/M
Scaffold IDGa0079045_1000219 Open in IMG/M
Source Dataset NameHot spring microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_virus_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9086
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (47.06%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Sulfolobales → Sulfolobaceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Yellowstone National Park
CoordinatesLat. (o)44.7315Long. (o)-110.7113Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008949Metagenome / Metatranscriptome325Y
F011097Metagenome / Metatranscriptome295Y
F021133Metagenome / Metatranscriptome220N
F023140Metagenome / Metatranscriptome211Y

Sequences

Protein IDFamilyRBSSequence
Ga0079045_100021910F021133N/AMGRRDDLIRQIYENGNYAIKKICEMEPDDKMANFSATDCIIGTTNAHLALKIAKEKGYPQDVIEYLENQSKQEQWHCRLHIGKPPKLYDFVVAQKHREILLKYGIYVWMGVMPLLGEKIALAKAICWRRDDDPHFVNKFATVDEYYHTTYPLLLLYKYASEEELEKIVELQKEYIVNIFKLK*
Ga0079045_100021912F023140N/ALKLHERILISNVFIGLATVPIYIDLKSFPFFIVFGAGILTTLTVLILFFYFLGAKFVGTWAILQKFAVTLPTSFVLAHLVKLLSTNPLLDYVILFVVGYSISTPLIFLTYNVTKWLYGKKR*
Ga0079045_100021915F008949AGGAGGMSSQTVTLGTQTITPKVQDLGNTYYIEFQVKITKYLNNPVNQTIDVKFICNKYKQVVVPSTNPLSPPTVQTVQKSIQECVDEWYDQHKSVYEVA*
Ga0079045_100021916F011097GGAGGMIRDVVLGTSGGTDPFTNLPVGGGPFSNGSIGQLLRFHPNYARLLILVTGLSGTSPSIQFTVGSYYGSINYTLPPISSPQYVQIIGNENKTIITYLNTSWQVLQQVELPYNIFLNGVNVSWSLSGTSPAVTMYIHFEFEDEEEDEE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.