NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075367_10511402

Scaffold Ga0075367_10511402


Overview

Basic Information
Taxon OID3300006178 Open in IMG/M
Scaffold IDGa0075367_10511402 Open in IMG/M
Source Dataset NamePopulus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)762
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location NameUSA: Tennessee
CoordinatesLat. (o)35.8444Long. (o)-83.9599Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049101Metagenome / Metatranscriptome147Y
F080395Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0075367_105114021F080395N/AVTALFLAALALAPALQDLHVTNGSTPFAGDNRLLTTVSPNGDGFRDTAVVHFRLTRAARLDLDVLATNMVRAGEGGT
Ga0075367_105114022F049101N/AMRRLLTFAVLALALALPAGVSARTTTSADGTLSVKDARGVVTIQGRGAVIGSFAKGSVTINDPIDGDGTGPIVTGDEWSKEKTDTATIWGGTKVRFRIIGGTFRIVVRGRGINLSFVGKGGVILNGAGTDDDGSYATNGGDYNLIPAFALP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.