Scaffold Ga0070712_100539041

Overview

Basic Information

• Taxon OID: 3300006175
• Scaffold ID: Ga0070712_100539041
• Source Dataset Name: Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 982
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: Michigan: Kellogg Biological Station
• Coordinates
  • Lat. (^o): 42.4774
  • Long. (^o): -85.451

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076343	Metagenome / Metatranscriptome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0070712_1005390411	F076343	AGGAGG	MKRMIPIVDLKTGQVSDRWSDTSTLDVPSDLDRDAGVASLVKSQAHYRSTIGRNVNGPTYPRPLSWRVRGEECLVADPAQAGTKLAGYTLMAVDPGPHD*