Scaffold Ga0082029_1601523

Overview

Basic Information

• Taxon OID: 3300006169
• Scaffold ID: Ga0082029_1601523
• Source Dataset Name: Termite nest microbial communities from Madurai, India
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: BGI Tech Solutions Co., Ltd.
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 578
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest → Termite Nest Microbial Communities From Madurai, India

Source Dataset Sampling Location

• Location Name: MKU,India
• Coordinates
  • Lat. (^o): 9.941418
  • Long. (^o): 78.008896

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036907	Metagenome / Metatranscriptome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082029_16015231	F036907	N/A	QPTGSIVVASGNGASFNATQVNGPKVHASQRSDGSWGGTINAGGSFPTPIDATFQGGQFVGSNIRLSINREGGLTTIVGSVLDRIVRIEVTETEIRVRTGTKSLNFVKLAGPGEYGGAQSMKLLGEAQQAPPTPAFALAMVGAFI*