Scaffold Ga0082029_1174986

Overview

Basic Information

• Taxon OID: 3300006169
• Scaffold ID: Ga0082029_1174986
• Source Dataset Name: Termite nest microbial communities from Madurai, India
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: BGI Tech Solutions Co., Ltd.
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 828
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter radiotolerans (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest → Termite Nest Microbial Communities From Madurai, India

Source Dataset Sampling Location

• Location Name: MKU,India
• Coordinates
  • Lat. (^o): 9.941418
  • Long. (^o): 78.008896

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020995	Metagenome / Metatranscriptome	221	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082029_11749862	F020995	GGAGG	VKKAIAIKLIKSKTARRVAVKAAMNPRVRKIILDQVRRKVVGR*