NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0007818_1014657

Scaffold Ga0007818_1014657


Overview

Basic Information
Taxon OID3300006117 Open in IMG/M
Scaffold IDGa0007818_1014657 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1598
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007918Metagenome / Metatranscriptome342Y
F010534Metagenome / Metatranscriptome302N
F014823Metagenome / Metatranscriptome259N
F042163Metagenome / Metatranscriptome158N

Sequences

Protein IDFamilyRBSSequence
Ga0007818_10146571F042163N/AMHLTVKITEQVEKKLEAVLKGKYDNRTIWMYYKASLQMLRDILENLIACHHTTHSLAEKDLYYEQNKVQIVDWI
Ga0007818_10146572F010534AGAAGGMSDKVGEKQEAIMNLIDQQIKGALKDQASGLEILQDRIKDAIDIGTTEHSQGIKQVMLFVTKAHVQAWITSLKHKVDTAGDCEICDLEKILGEESLEIAEAVKVALSNRNEETRNRILGELLEKTITKIEALSVRVSPAP*
Ga0007818_10146573F007918N/AMCDTTLEESDLFLNPEQNTEAGINQELSVIKQELLSILANVETVTEAMDRAILKEEDRREQFRTLCSLIDHSFGENIEMIEKRKDDLKEIDPSLQAIDCKLSTRMERLRDVAIKPDLKSMKIEMEKVLSQQRIEKFQTNPQQEEQRPQKG*
Ga0007818_10146574F014823N/AMSKKSNKSKDGTPILIDYSLYRDMQEDVREGSQAADELTSVVAQIIYKEIKRRKEFRSLLVSVEQTLSTSMRRVHRKVIELRKENSKISKEVLELEFDLERIREVVMSPNLEQMRTLIEDIYDWRVYRQSRSEKEMENLQSIAVAEEKVDLPESLEIL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.