Scaffold Ga0082037_1000002

Overview

Basic Information

• Taxon OID: 3300006094
• Scaffold ID: Ga0082037_1000002
• Source Dataset Name: Petroleum reservoir microbial communities from Reconcavo Basin, Brazil, analyzing oil degradation - Bahia-well BA- 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 407884
• Total Scaffold Genes: 469
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 393 (83.80%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Petroleum Reservoir → Petroleum Reservoir Microbial Communities From Reconcavo Basin, Brazil, Analyzing Oil Degradation

Source Dataset Sampling Location

• Location Name: Brazil: State of Bahia
• Coordinates
  • Lat. (^o): -12.2
  • Long. (^o): -38.11
  • Depth (m): 500 to 1000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038519	Metagenome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082037_100000292	F038519	AGGA	MQMHVIAYEPSADWAGPYTNQELLKRTLAIIQQVDRTAEVISKETDPWAEQILAGLLPYKIHVDLVDGMPQLPAAVSITWPPAQLEGIQIGSQEFREYFVWAKSEVAALRKLATLNKTPSAAKPAAATEEA*