Scaffold Ga0082015_1024679

Overview

Basic Information

• Taxon OID: 3300006090
• Scaffold ID: Ga0082015_1024679
• Source Dataset Name: Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Major University, Chile
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 1004
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Eastern Tropical South Pacific Oxygen Minumum Zone, Cruise Nbp1315, 2013

Source Dataset Sampling Location

• Location Name: Eastern Topical South Pacific
• Coordinates
  • Lat. (^o): -13.71
  • Long. (^o): -81.389
  • Depth (m): 250

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016058	Metagenome / Metatranscriptome	250	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082015_10246792	F016058	AGGAG	MSKKTEVMEEVKTNNVVEPVDTDAKAKEAIETLKTQLQEHLRQAEHHRTMATKAQGALEVLLQLHPEEGNSEG*