Basic Information | |
---|---|
Taxon OID | 3300006090 Open in IMG/M |
Scaffold ID | Ga0082015_1020401 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Major University, Chile |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1118 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Eastern Tropical South Pacific Oxygen Minumum Zone, Cruise Nbp1315, 2013 |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Eastern Topical South Pacific | |||||||
Coordinates | Lat. (o) | -13.71 | Long. (o) | -81.389 | Alt. (m) | Depth (m) | 250 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F076176 | Metagenome / Metatranscriptome | 118 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0082015_10204012 | F076176 | N/A | MPKFKKWELHTEQIQDEQWSTHKIKALWKKNPKFEKWFKKNVLDDYSKESGHRFYPSKFRGEYGRNRRCLNLK* |
⦗Top⦘ |