Scaffold Ga0081762_1158194

Overview

Basic Information

• Taxon OID: 3300006083
• Scaffold ID: Ga0081762_1158194
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS908_Marker33_DNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1783
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: Axial seamount, northeast pacific ocean
• Coordinates
  • Lat. (^o): 45.9332
  • Long. (^o): -129.982268
  • Depth (m): 1516

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090504	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0081762_11581942	F090504	N/A	MMVIFLVLTIIIFGLILPYWAGVIAKRKGKSFVLWCILQVLFLFPIVLIAFHAPVEKEK*