Scaffold Ga0081595_1001860

Overview

Basic Information

• Taxon OID: 3300006078
• Scaffold ID: Ga0081595_1001860
• Source Dataset Name: Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid C
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Max Planck Institute for Plant Breeding Research
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6834
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (70.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids → Microbial Communities In Diffuse Hydrothermal Fluids Of Manus Basin, Bismarck Sea

Source Dataset Sampling Location

• Location Name: Manus Basin, Bismarck Sea
• Coordinates
  • Lat. (^o): -3.728333
  • Long. (^o): 151.672394

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008525	Metagenome / Metatranscriptome	332	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081595_10018606	F008525	AGGA	METFKESFNLLIEKKLALPKGETVAKELTKLGKKKKITAVITSKFNLYIDGDRLDKFKSVKEAEKALKEFIKAMDL*