Scaffold Ga0075017_101675752

Overview

Basic Information

• Taxon OID: 3300006059
• Scaffold ID: Ga0075017_101675752
• Source Dataset Name: Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 502
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location

• Location Name: Pennsylvania, USA
• Coordinates
  • Lat. (^o): 41.1752
  • Long. (^o): -78.4168

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099096	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075017_1016757521	F099096	AGGAGG	MSGTYTSLMILEGILTAAAALMFLYRSMLDMREEDHVILDQAESHLAREQASIRQRVTVVSKYLKVVSIVWAVLLVVIVCLWVAHG