Scaffold Ga0097691_1123608

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0097691_1123608

Scaffold Ga0097691_1123608

Overview

Basic Information
Taxon OID	3300006055 Open in IMG/M
Scaffold ID	Ga0097691_1123608 Open in IMG/M
Source Dataset Name	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	721
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location Name	Barrow Environmental Observatory site, Barrow, Alaska
Coordinates	Lat. (^o)	71.2999	Long. (^o)	-156.61	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002437	Metagenome / Metatranscriptome	559	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0097691_11236082	F002437	GGAG	MKLSKIGIQRFLQVSSALVILGLLLEIASLLWFHPLSFVLFAFVSASLTGLGILVYLVSLVFVSRAPRENSNSEGERA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.