Scaffold Ga0066651_10471594

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066651_10471594

Scaffold Ga0066651_10471594

Overview

Basic Information
Taxon OID	3300006031 Open in IMG/M
Scaffold ID	Ga0066651_10471594 Open in IMG/M
Source Dataset Name	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	665
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location Name	USA: California: Angelo Coastal Reserve
Coordinates	Lat. (^o)	39.7392	Long. (^o)	-123.6308	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016338	Metagenome / Metatranscriptome	248	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066651_104715942	F016338	GGAGG	MSGREIDDLLLDIKGLVLVREILKQRGATPAELEAHTVELERLKDRLAELAVPATVGS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.