Scaffold Ga0068875_1027086

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068875_1027086

Scaffold Ga0068875_1027086

Overview

Basic Information
Taxon OID	3300006018 Open in IMG/M
Scaffold ID	Ga0068875_1027086 Open in IMG/M
Source Dataset Name	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	521
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location Name	USA: Ohio, Lake Erie
Coordinates	Lat. (^o)	41.69957	Long. (^o)	-83.2941	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100733	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068875_10270861	F100733	AGGAGG	MRKRNTETRFACTCNGCRNYPTMPAQIWHEAQIPSKEQGTFFFRKDTMKFFSSRIVDFKPVNRGGEIDSLSVIVSNRHGYEGASRYYEVVVLCPYGTIHREGESFDTLRKARREWDNALAGFAPCECHGCQLD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.