NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081539_10011059

Scaffold Ga0081539_10011059


Overview

Basic Information
Taxon OID3300005985 Open in IMG/M
Scaffold IDGa0081539_10011059 Open in IMG/M
Source Dataset NameTabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7214
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (91.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere → Tabebuia Heterophylla Rhizosphere Microbial Communities From The University Of Puerto Rico

Source Dataset Sampling Location
Location NameUniversity of Puerto Rico, San Juan, Puerto Rico
CoordinatesLat. (o)18.402889Long. (o)-66.050054Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010254Metagenome / Metatranscriptome306Y
F014343Metagenome / Metatranscriptome264Y
F073749Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0081539_100110595F073749AGGAGMTFDDYQACFNALFAADRQFNLVQARFAASGAAGATLDAFQLLRLAMVQCLERLEQQYARQYPDHELADVCALLEAQRAPEDQRDGELVLQDVLRRPAAETRSHAPAWYDR*
Ga0081539_100110596F014343AGGAGGMTASAVGYPQVRAWVKAMLGRTHATVVHTMAWAVLCLLVAQRATPAALARALPADQAGRARARLTRVRRWWTGPPLDQGVVSPQLIHTALALLPPGQAVVVALDTTRLGPWEVWLAGIVVAGRTMPIGWAVLPYPWPKGRFRTTTLALVRQVQAAFPATVPWTLVADRGFPSALLFALLWQGGTRFSVRLRLSDWVMVAGVYTTIAEHLVAGRLVDGQRTAATMGRGRPDQPLVPGWVVVSAAVADLPKHKQNPGTVRERAKRAKAHAQHRAHKQGRKTKPPSATAQRYTQTWVLFTTALTVGQAVAAYAQRMPIEETFRDWHSGWGVRAAVVDLPTAAMVDRLIGVVCVTYSLQMQLGQRFSADPLGQQRREQWTVTDRVSWFWCGQRLLNDPGYDWSGWLAAQWEALTIPPASVVSEPESVPMLAAAA*
Ga0081539_100110598F010254GAGMTDWREALQDAMYPVLTRLLQEGFVLPLFVTCIGRNGSMMCGRYDDIEATGLDFIFEAWHVEGEVFPTPLHMLVVDQRGEGRHVWHQREGRQDAHDPCL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.