Scaffold Ga0081529_125130

Overview

Basic Information

• Taxon OID: 3300005964
• Scaffold ID: Ga0081529_125130
• Source Dataset Name: Ferrous microbial mat and aquatic microbial communities from Echinus Geyser, Yellowstone National Park, USA - transect B T=78-80 C
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1470
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat And Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Echinus Geyser, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.7220558
  • Long. (^o): -110.7021057

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085903	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081529_1251302	F085903	N/A	MFKIAFCVLVGVNSLLKAFITAVVIVLIVAGSLYETAIGMKTSDYALYLKAHPPALALFIVLYALFGLFFYIIVRWWS*