Scaffold Ga0081529_117428

Overview

Basic Information

• Taxon OID: 3300005964
• Scaffold ID: Ga0081529_117428
• Source Dataset Name: Ferrous microbial mat and aquatic microbial communities from Echinus Geyser, Yellowstone National Park, USA - transect B T=78-80 C
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1104
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Desulfurococcales → Desulfurococcaceae → unclassified Desulfurococcaceae → Desulfurococcaceae archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat And Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Echinus Geyser, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.7220558
  • Long. (^o): -110.7021057

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020733	Metagenome / Metatranscriptome	222	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081529_1174282	F020733	AGG	MSEIVWDDEKKEYVRAEEIRERKLKREIINELIQALQSDYTLQIKINLQTGQGEIIIIPKPKQT*