Scaffold Ga0073922_1020815

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073922_1020815

Scaffold Ga0073922_1020815

Overview

Basic Information
Taxon OID	3300005955 Open in IMG/M
Scaffold ID	Ga0073922_1020815 Open in IMG/M
Source Dataset Name	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	786
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Unclassified → Sand → Groundwater Microbial Communities From The Columbia River, Washington, Usa

Source Dataset Sampling Location
Location Name	USA: Columbia River, Washington
Coordinates	Lat. (^o)	46.372	Long. (^o)	-119.272	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094945	Metagenome / Metatranscriptome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0073922_10208152	F094945	N/A	LTEEQVRLARIYVMKGPVGTLPLCARHWKVGVQTLRNAVIYKNWKHVPPPTASELADTPLPHWIDSIGAPHRSHCGMCVHWCGVRSCTMGIPEAGGFFATSCAAYATTSLAD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.