NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081455_10335485

Scaffold Ga0081455_10335485


Overview

Basic Information
Taxon OID3300005937 Open in IMG/M
Scaffold IDGa0081455_10335485 Open in IMG/M
Source Dataset NameTabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1072
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere → Tabebuia Heterophylla Rhizosphere Microbial Communities From The University Of Puerto Rico

Source Dataset Sampling Location
Location NameUniversity of Puerto Rico, San Juan, Puerto Rico
CoordinatesLat. (o)18.402889Long. (o)-66.050054Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005864Metagenome / Metatranscriptome388Y
F006486Metagenome / Metatranscriptome372Y

Sequences

Protein IDFamilyRBSSequence
Ga0081455_103354852F006486AGGVNKDSDQTETAPRKFKLGHLGSLNQVIVALGKTIRAMADGTLDSQVGARICNGLGIMRACLETRKLEQLESRMDEIAERVARDRTRPAHDRTGSDEAQRLSH*
Ga0081455_103354853F005864AGGAMKPSAFRIERMLEKLEAALVPPERKVLRVIIDGDDVVKAKKKQEALAAHVARHPEDAGRTVDDFNWIERTLVRPRVLTDG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.