Scaffold Ga0075130_100041

Overview

Basic Information

• Taxon OID: 3300005927
• Scaffold ID: Ga0075130_100041
• Source Dataset Name: Saline lake microbial communities from Deep Lake, Antarctica, in enrichment culture - Antarctic Deep Lake Metagenome VIREN14
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 46821
• Total Scaffold Genes: 70
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 38 (54.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Haloferacalesvirus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake Enrichment → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Deep Lake, Antarctica
• Coordinates
  • Lat. (^o): -68.5563
  • Long. (^o): 78.1877
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051583	Metagenome	144	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0075130_1000413	F051583	GGCGG	MTLHVPLTVGRSAPEGTQPNMDYTNPEDVANIDEPTRQQEIGLLSGLIDGKFVCVNHRGFLVNRTDNGSIELSRDGEVLGGRYYVTENNFAGLIEWLNAKAALYGETA*