Scaffold Ga0075129_100671

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0075129_100671

Scaffold Ga0075129_100671

Overview

Basic Information
Taxon OID	3300005923 Open in IMG/M
Scaffold ID	Ga0075129_100671 Open in IMG/M
Source Dataset Name	Saline lake microbial communities from Deep Lake, Antarctica, in enrichment culture - Antarctic Deep Lake Metagenome VIRDL14
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1153
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Deep Lake, Antarctica
Coordinates	Lat. (^o)	-68.5563	Long. (^o)	78.1877	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003128	Metagenome	506	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075129_1006711	F003128	GAGG	MQIEVSASDIKSDKKADDRGRVTLGSEYAGKSVAVAVLEVKDEDDVRTDGG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.