Scaffold Ga0075285_1043018

Overview

Basic Information

• Taxon OID: 3300005890
• Scaffold ID: Ga0075285_1043018
• Source Dataset Name: Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 592
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Source Dataset Sampling Location

• Location Name: USA: Twitchell Island, California
• Coordinates
  • Lat. (^o): 38.1087
  • Long. (^o): -121.653
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017009	Metagenome / Metatranscriptome	243	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075285_10430182	F017009	GAGG	VPEEVVFLSVLAMIGSAVLLFPVMRALAERIRPRAVDSGVRDELQILREDLLAEIQQVRREIGDFGERVDFTERLLAKKTDR*