Scaffold Ga0080455_1144265

Overview

Basic Information

• Taxon OID: 3300005882
• Scaffold ID: Ga0080455_1144265
• Source Dataset Name: Hydrocarbon microbial community from Halfdan Field MHF
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Shell Corporation
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 535
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location

• Location Name: Halfdan Field, North Sea, Denmark
• Coordinates
  • Lat. (^o): 55.49
  • Long. (^o): 7.42

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006143	Metagenome	380	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0080455_11442651	F006143	GGAGG	MSTEEETPIEEKKTTTTKFAEWLMARQEKKEAKETSLESLMKFNVFLSIATLVTVAGAT