Scaffold Ga0080003_1008467

Overview

Basic Information

• Taxon OID: 3300005859
• Scaffold ID: Ga0080003_1008467
• Source Dataset Name: Hot spring microbial communities from Joseph's Coat, Yellowstone National Park, USA - JC2_E (SPADES assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2750
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (37.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Joseph's Coat, Yellowstone National Park, Washington, USA
• Coordinates
  • Lat. (^o): 44.376
  • Long. (^o): -110.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080244	Metagenome / Metatranscriptome	115	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0080003_10084674	F080244	N/A	MVKVQDLMAELFLGSFLILMSVFIVTNTSLLQSQNIVQLFVTLNLSILSIISGIYSKSYPKENKTDELVKDITALLFIGFVTAILLIGSLLNTQIIENQYMWGQLFSDVTALIYIVTGISSTDYSSEKQNKV*