Scaffold Ga0080003_1005850

Overview

Basic Information

• Taxon OID: 3300005859
• Scaffold ID: Ga0080003_1005850
• Source Dataset Name: Hot spring microbial communities from Joseph's Coat, Yellowstone National Park, USA - JC2_E (SPADES assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3899
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Hydrogenobaculum → unclassified Hydrogenobaculum → Hydrogenobaculum sp. Y04AAS1 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Joseph's Coat, Yellowstone National Park, Washington, USA
• Coordinates
  • Lat. (^o): 44.376
  • Long. (^o): -110.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083455	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0080003_10058501	F083455	AGGAGG	MMHMDLFSYQLDIGSLWVKDVVVALLGIAILVSLTLANKKGENLFVQVAMMIPVLYTIHYLPHINYISINGIFDDVIIAVGISLVFDFITTETQRPDLKYRFINVYILFTLYAIIKYQSNVLKFALDSLLMIPVLVLLTFIPPADEL*