Scaffold Ga0080008_164128

Overview

Basic Information

• Taxon OID: 3300005854
• Scaffold ID: Ga0080008_164128
• Source Dataset Name: Hot spring microbial streamer communities from Conch Spring, Yellowstone National Park, USA - CON_C (SPADES assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 529
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Conch Spring, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.376
  • Long. (^o): -110.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075483	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0080008_1641281	F075483	GAGG	MFELLAVQAITTAALAIFVIKLRRELYPMVATAGPGFENLPLFWIRSIDVLVVETPQIEASKTVTRVRWLLEEELYLRYRFRVYYVAIHPHSHHNYKMWKAWMQGDDRYECMVEKPRGLSKLYNKAIDVICKEKEPPKEVIILPSKVRKR