Basic Information | |
---|---|
Taxon OID | 3300005854 Open in IMG/M |
Scaffold ID | Ga0080008_139745 Open in IMG/M |
Source Dataset Name | Hot spring microbial streamer communities from Conch Spring, Yellowstone National Park, USA - CON_C (SPADES assembly) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1251 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Conch Spring, Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013155 | Metagenome / Metatranscriptome | 274 | Y |
F075483 | Metagenome / Metatranscriptome | 119 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0080008_1397451 | F075483 | AGAAG | MIELLAIQTITTAALAFFVIKLRRELYPMVATAGPGFENLPLFWIRSIDVLVLEAPQFEASKTVTRVRWLLEEELYLRYRFRVYDVAIHPYRRYYYKMWKAWMQGDDRYECRVKKPRGLSRLYNKAIDVICKEKEPPKEVEIIPTWARKWRYKRRLRELREAARRRSAEKSNK* |
Ga0080008_1397452 | F013155 | N/A | MELYQIIIVAIALANLAVTVWLLRLLYPVWRELRDIAFALDNYDFEKLTQQFLNGEKPLSETIHIKTTENKEEGYKEVIITRAYKKPLDPREVQENFVRQMAEKLQ* |
⦗Top⦘ |