Basic Information | |
---|---|
Taxon OID | 3300005852 Open in IMG/M |
Scaffold ID | Ga0079998_119667 Open in IMG/M |
Source Dataset Name | Thermal spring microbial communities from Yellowstone National Park, Wyoming, USA - Perpetual Spouter B (PS_B) MetaG (SPADES assembly) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 7849 |
Total Scaffold Genes | 13 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (76.92%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → Pyrobaculum ferrireducens | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013155 | Metagenome / Metatranscriptome | 274 | Y |
F075483 | Metagenome / Metatranscriptome | 119 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0079998_11966710 | F075483 | GAGG | MIELLAVQAVTTLALAFFVIKLRRELYPMIATAGPVHAGFWIRSIDVMVLAAPQLEVAKTVIKIRRLLEEELFLKYSLKFYDVAMHPTSQHHYRMWKAWMQGDDRYKCEVEKPRGLSRLYNKAVEVFCREKEPPKEVIILPSKVRKRRYKRMLRQLREARRNSAEKPT* |
Ga0079998_1196679 | F013155 | GGAG | VAVIAIALANLAVTVWLLRLLIPVWQTLRKIVFVLDQYDFDKLAKEFLSNEKPLAETIDVKVSEKKEEGYRELTVTRVYRKPLDPREIQEGFVRQMAERLQ* |
⦗Top⦘ |