Scaffold Ga0068707_1007001

Overview

Basic Information

• Taxon OID: 3300005839
• Scaffold ID: Ga0068707_1007001
• Source Dataset Name: Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP NP MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7503
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location

• Location Name: USA: Wyoming: Yellowstone National Park
• Coordinates
  • Lat. (^o): 44.963
  • Long. (^o): -110.715

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069605	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068707_10070016	F069605	AGGAG	MAFGDGGLSSSGVVNRLVSVVIGEKSGVSGALNGAGDALLDQI*