NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074470_11310294

Scaffold Ga0074470_11310294


Overview

Basic Information
Taxon OID3300005836 Open in IMG/M
Scaffold IDGa0074470_11310294 Open in IMG/M
Source Dataset NameMicrobial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon Health and Science University (OHSU)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)148614
Total Scaffold Genes142 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)104 (73.24%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location NameAstoria, Oregon, USA
CoordinatesLat. (o)46.15968Long. (o)-123.80651Alt. (m)Depth (m).06
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059091Metagenome134Y
F080658Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0074470_11310294117F059091AGCAGGMSTSPAKPRLVPCHFTVDDLQLIEWSCREKAQRARTDAKRDATPSSIETSTSTATKYEVLASRIQRLKELGMR*
Ga0074470_11310294140F080658GGAGGVVTSTVVLNGQLIIEGVKFLWWVTDGRPARLTVSHPLHGTKTKLAERNPEQQAKVLARSMFGGDAPHGETPGA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.