NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074470_10181865

Scaffold Ga0074470_10181865


Overview

Basic Information
Taxon OID3300005836 Open in IMG/M
Scaffold IDGa0074470_10181865 Open in IMG/M
Source Dataset NameMicrobial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon Health and Science University (OHSU)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15922
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location NameAstoria, Oregon, USA
CoordinatesLat. (o)46.15968Long. (o)-123.80651Alt. (m)Depth (m).06
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029132Metagenome / Metatranscriptome189Y

Sequences

Protein IDFamilyRBSSequence
Ga0074470_101818654F029132AGGMSEPNVLVNFRLDRERPLRLKWLATDGVPGDGYKPQVTAIRLADGATLQMDSSAILEQAAPDPAGGIGGYLVTFNGMVGFAADHPDRARIDLITDGEIAYDLEFVTEDGKVAVEDQDYKILERPPGAVHKLSRRE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.