Scaffold Ga0078910_108703

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0078910_108703

Scaffold Ga0078910_108703

Overview

Basic Information
Taxon OID	3300005835 Open in IMG/M
Scaffold ID	Ga0078910_108703 Open in IMG/M
Source Dataset Name	Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 1 to 3 kb reads
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Norwegian Sequencing Centre (NSC)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1966
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities

Source Dataset Sampling Location
Location Name	Alnarp, Sweden
Coordinates	Lat. (^o)	59.8152338	Long. (^o)	17.6620518	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091649	Metagenome / Metatranscriptome	107	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0078910_1087035	F091649	AGAAGG	MPTYDDPDYEWKQMVKKNGICDPYEESIREFKEEFERIEKKLKQTGG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.