Scaffold Ga0074472_10043028

Overview

Basic Information

• Taxon OID: 3300005833
• Scaffold ID: Ga0074472_10043028
• Source Dataset Name: Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon Health and Science University (OHSU)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2127
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Cathlamet Bay
• Coordinates
  • Lat. (^o): 46.18749
  • Long. (^o): -123.58892
  • Depth (m): .02

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013146	Metagenome	274	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074472_100430282	F013146	AGGAG	MPQRLLPYRTASFVGFVGIWLFAVIALARLPALGPAETPVHGLAWIGVVAAAVLMGRAWWNLAPEIFGTRMPLAAFVLLVLFVAWVWIWFAIVLVKCEGTIRTCGPWRLALDVGAFAMWATLAWVVWWRTRRWPVAALVLLGNIGARLPIYVSGLPPWMRPLGIIVLSGGLILALVALFRSAEKPRAKPGTHTLFAAAWFRLVLVVAALGTLLVLSVPYLLSWLTP*