Scaffold Ga0074469_11241275

Overview

Basic Information

• Taxon OID: 3300005832
• Scaffold ID: Ga0074469_11241275
• Source Dataset Name: Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon Health and Science University (OHSU)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3711
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Ilwaco, Washington, USA
• Coordinates
  • Lat. (^o): 46.28551
  • Long. (^o): -124.05187
  • Depth (m): .06

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000763	Metagenome / Metatranscriptome	901	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074469_112412754	F000763	AGAAGG	MKTYMKNPIVLAAGAFLAAWASSNFDLDYRAILWAVLSGIFGYATPKK*