Scaffold Ga0074473_10929184

Overview

Basic Information

• Taxon OID: 3300005830
• Scaffold ID: Ga0074473_10929184
• Source Dataset Name: Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon Health and Science University (OHSU)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1502
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Astoria, Oregon, USA
• Coordinates
  • Lat. (^o): 46.17784
  • Long. (^o): -123.85335
  • Depth (m): .02

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008787	Metagenome / Metatranscriptome	328	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074473_109291843	F008787	AGGAG	MTQPLQTRRFKEALMRVKQLFLETPGATLTTADAAQMAGLDMQVCGRLLHSLIDAGFLEERLGGVFVRSPSRHR*