Scaffold Ga0074475_10959212

Overview

Basic Information

• Taxon OID: 3300005828
• Scaffold ID: Ga0074475_10959212
• Source Dataset Name: Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon Health and Science University (OHSU)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1527
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Ilwaco, Washington, USA
• Coordinates
  • Lat. (^o): 46.30247
  • Long. (^o): -123.03645
  • Depth (m): .02

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008079	Metagenome / Metatranscriptome	339	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074475_109592125	F008079	N/A	MKIKDEFIGAKISHKGNRITLDANRYDYFVSIGLGYMFEEPTVSEPKVIKYKAVKGPIPTPVVDEPTVESEEDGTEAE*