NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074475_10903938

Scaffold Ga0074475_10903938


Overview

Basic Information
Taxon OID3300005828 Open in IMG/M
Scaffold IDGa0074475_10903938 Open in IMG/M
Source Dataset NameMicrobial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon Health and Science University (OHSU)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3180
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (9.09%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location NameIlwaco, Washington, USA
CoordinatesLat. (o)46.30247Long. (o)-123.03645Alt. (m)Depth (m).02
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070891Metagenome / Metatranscriptome122N
F091365Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0074475_109039385F070891N/AMTQINKPFKTKEMKKLYEILFEDKKPEEQPLKLEIKLKSTATPEEQLEINEWYRHVYNSLQRN*
Ga0074475_109039387F091365N/AMKMYSQAELSTMQEMAKKPISTTRLAKRLAKQFNRTYGGVYAKLLVMRKHTKVEPVITNTVRTKTVVEGKKHTISSRPTKIEISDQGMTFYF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.