Scaffold Ga0074475_10533089

Overview

Basic Information

• Taxon OID: 3300005828
• Scaffold ID: Ga0074475_10533089
• Source Dataset Name: Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon Health and Science University (OHSU)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 15842
• Total Scaffold Genes: 26
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (30.77%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Ilwaco, Washington, USA
• Coordinates
  • Lat. (^o): 46.30247
  • Long. (^o): -123.03645
  • Depth (m): .02

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042355	Metagenome / Metatranscriptome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074475_1053308926	F042355	N/A	MSNDLKQQNKVKKNSRRTNNLQEPKFVERLIKISRVSKVTK