NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078745_1154679

Scaffold Ga0078745_1154679


Overview

Basic Information
Taxon OID3300005823 Open in IMG/M
Scaffold IDGa0078745_1154679 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf, MM2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAarhus University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)643
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark

Source Dataset Sampling Location
Location NameAarhus Bay station M5
CoordinatesLat. (o)56.10555Long. (o)10.463333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023034Metagenome / Metatranscriptome211Y

Sequences

Protein IDFamilyRBSSequence
Ga0078745_11546792F023034AGAAGMNVKSYNTRDYENIANWTLGQNKPNSNPIKPNLKRAKMNVNSFITRDYRKKDDFAVQKNK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.