NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079957_1122736

Scaffold Ga0079957_1122736


Overview

Basic Information
Taxon OID3300005805 Open in IMG/M
Scaffold IDGa0079957_1122736 Open in IMG/M
Source Dataset NameMicrobial and algae communities from Cheney Reservoir in Wichita, Kansas, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1370
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Microbial And Algae Communities From Cheney Reservoir In Wichita, Kansas, Usa

Source Dataset Sampling Location
Location NameWichita, Kansas, USA
CoordinatesLat. (o)37.7330997Long. (o)-97.7990663Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002687Metagenome / Metatranscriptome536Y

Sequences

Protein IDFamilyRBSSequence
Ga0079957_11227361F002687N/ASGSATLSSASTYVGNQSVRSAVFAVSVEVFQSRIAAGGQIEGVDFTATPFRMGRSLFNRCVGLLGAYLDVESMAQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.