Scaffold Ga0079957_1021122

Overview

Basic Information

• Taxon OID: 3300005805
• Scaffold ID: Ga0079957_1021122
• Source Dataset Name: Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4535
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 11 (84.62%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → unclassified Methylotenera → Methylotenera sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Microbial And Algae Communities From Cheney Reservoir In Wichita, Kansas, Usa

Source Dataset Sampling Location

• Location Name: Wichita, Kansas, USA
• Coordinates
  • Lat. (^o): 37.7330997
  • Long. (^o): -97.7990663

Associated Families

Family	Category	Number of Sequences	3D Structure?
F086586	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079957_10211223	F086586	GGAG	MKKLLYVLLAFAVLGALLVAIPWLGFWAVNTLFAFDIPFTWGTGLAFWVLIALFRGGETTFRRGTEV*