NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078257_117067

Scaffold Ga0078257_117067


Overview

Basic Information
Taxon OID3300005762 Open in IMG/M
Scaffold IDGa0078257_117067 Open in IMG/M
Source Dataset NameAlgae and Fungi communities from freshwater lake in Auvergne, France - sample CCAP7 day 4 of algae bloom
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterInstitut Pasteur, Lille, France
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)752
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Algae And Fungi Communities From Freshwater Lake In Auvergne, France During And After Algae Bloom

Source Dataset Sampling Location
Location NameAuvergne, France
CoordinatesLat. (o)45.495847Long. (o)2.887922Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073578Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0078257_1170671F073578N/ALYDYKLCFLVARPLFDIFHNKTASMSSSNNNNKTNDHGASLYAHRFAEEAKEEEMEAIAGAMLPQDAKKKYVVGSSKVEYQKKKAAVIMPPQDGNDSSNIFVPAVSSSTADVVAAPSQQHVRPGAFVVRGPGFIPHDDSFLHVDTAPTSTNNVQDELEQLEPESLFKAVLVDDPEIPSASIFDHEAAEKAYCRRQGWKVLATFAAIGILGAIIAIVIWKLKPPSSTSSPTLSPTLSPTLSPTLSPTLSPT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.