NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078205_141078

Scaffold Ga0078205_141078


Overview

Basic Information
Taxon OID3300005760 Open in IMG/M
Scaffold IDGa0078205_141078 Open in IMG/M
Source Dataset NameAlgae and Fungi communities from freshwater lake in Auvergne, France - sample AST3 at day 1 of algae bloom
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterInstitut Pasteur, Lille, France
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1801
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Algae And Fungi Communities From Freshwater Lake In Auvergne, France During And After Algae Bloom

Source Dataset Sampling Location
Location NameAuvergne, France
CoordinatesLat. (o)45.495847Long. (o)2.887922Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092089Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0078205_1410781F092089N/AMSDLSLFVSQDMKLLSTIGILLALSISFAFAGKSTFKFPGGLSKKNYVSSNIGKRILKGNSKKGSIMKKSRKKGARASTDSAPTVVQSYMNWAVCLHDRTSNKACSPQVGVPKGYYFLDSFDVSSSCSNTTIPVRKCNVPVDPKGEHLTVVIPVAVAFYFSYDNDPKGGICNETRPTGNDLLYVKTNVVNDDFNYTQLPYAFVNGRSLSMEYIIEDEPFYLKSCSNKVQCCDDCDVPSCVDCGGVDQYPTIGYVSTDTSTWKPGEKRYYQWGYGYEVDACDCSGCSMGRVELTAVEKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.